PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011099626.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family ZF-HD
Protein Properties Length: 353aa    MW: 38799.2 Da    PI: 9.6924
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011099626.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer106.31.8e-33140196360
     ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                     ++rY+eClkNhAa++Ggh+vDGCgEfmps geegt+++l+CaAC+CHRnFHR+ev+ e
  XP_011099626.1 140 NIRYRECLKNHAAAMGGHVVDGCGEFMPS-GEEGTPESLRCAACDCHRNFHRKEVDGE 196
                     689*************************9.999*********************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257749.0E-23139195IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047705.2E-31141193IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.7E-32142193IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.91143192IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466894.49E-20280350IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-30281351IPR009057Homeodomain-like
PROSITE profilePS500718.762287351IPR001356Homeobox domain
TIGRFAMsTIGR015654.1E-28289346IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MERRGQERDV GIPNSMGYTP PQMIQESPVK LPLAPILSTP PDRRANAMVS TRRGSSIFSP  60
TQTLDHHYNP PPPPQQHRQL SPPPPPPQQQ QPVVQKDHSP DPDPPPTTTP TTGGASNSKK  120
PTQPQAPPPV QGSAPSAAGN IRYRECLKNH AAAMGGHVVD GCGEFMPSGE EGTPESLRCA  180
ACDCHRNFHR KEVDGEQSHY YTYNPNTGNK NSHRNPILHG QTPSSAPPHH KHSLSYSQGF  240
TTGPTPPTMV NFGGNSGGAA AESSSEDLNM FQSGSGVHAT GQTSFSGSKK RFRTKFSQEQ  300
KDRMHEFATK LGWRIQKQDE KEVQEFCSEV GVKRQVFKVW MHNNKQAMKK RQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A9e-222883471675ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099626.10.0PREDICTED: zinc-finger homeodomain protein 6
TrEMBLA0A022RJ011e-117A0A022RJ01_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.12e-61homeobox protein 33